PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G51870.3
Common NameAGL71
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 25507.5 Da    PI: 9.9977
Description AGAMOUS-like 71
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G51870.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.51.7e-28959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k+ien + rqvtfskRr g++KKA+ELSvLCda+va i+fs++g+l+eyss
  AT5G51870.3  9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIVFSQSGRLHEYSS 59
                 68***********************************************96 PP

2K-box65.51.9e-22851711197
        K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                  e+  ++l+ e++++ k+i+ L+  +R+llG++L+s+s+ eLq++ +q+eksl+ +Rs+K el+ +q+++l++ke+el +e k+L ++
  AT5G51870.3  85 ERYLQELKMEIDRMVKKIDLLEVHHRKLLGQGLDSCSVTELQEIDTQIEKSLRIVRSRKAELYADQLKKLKEKERELLNERKRLLEE 171
                  566899***************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.272161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-32387IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-29323IPR002100Transcription factor, MADS-box
CDDcd002655.79E-42375No hitNo description
PfamPF003197.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.488179IPR002487Transcription factor, K-box
PfamPF014862.8E-2189171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAIVFSQ SGRLHEYSSS  60
QMEKIIDRYG KFSNAFYVAE RPQVERYLQE LKMEIDRMVK KIDLLEVHHR KLLGQGLDSC  120
SVTELQEIDT QIEKSLRIVR SRKAELYADQ LKKLKEKERE LLNERKRLLE EQNRERLMRP  180
VVPATLQICD KGNTEGGHRT KHSSEVETDL FIGLPVTRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-19173173Myocyte-specific enhancer factor 2B
1tqe_Q5e-19173173Myocyte-specific enhancer factor 2B
1tqe_R5e-19173173Myocyte-specific enhancer factor 2B
1tqe_S5e-19173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.296550.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248374_at0.0
Expression AtlasAT5G51870-
AtGenExpressAT5G51870-
ATTED-IIAT5G51870-
Function -- GeneRIF ? help Back to Top
  1. Role for AGL71 in the floral transition in the apical and axillary meristems.
    [PMID: 21609362]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G51870.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G48150
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G51870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412200.0AY141220.1 Arabidopsis thaliana MADS-box protein AGL71 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190517.11e-159MADS-box transcription factor AGL71
SwissprotQ9LT931e-142AGL71_ARATH; MADS-box protein AGL71
TrEMBLF4KEP61e-159F4KEP6_ARATH; Protein agamous-like 71
STRINGAT5G51870.31e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Helliwell CA,Wood CC,Robertson M,James Peacock W,Dennis ES
    The Arabidopsis FLC protein interacts directly in vivo with SOC1 and FT chromatin and is part of a high-molecular-weight protein complex.
    Plant J., 2006. 46(2): p. 183-92
    [PMID:16623882]
  7. Dorca-Fornell C, et al.
    The Arabidopsis SOC1-like genes AGL42, AGL71 and AGL72 promote flowering in the shoot apical and axillary meristems.
    Plant J., 2011. 67(6): p. 1006-17
    [PMID:21609362]